PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 232aa    MW: 27030.9 Da    PI: 4.9473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39021.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEde+l   v++lG ++W++ a+  g++R++k+c++rw +yl
       KHN39021.1  8 KGTWLQEEDEQLTSFVTRLGERRWDSLAKVAGLKRSGKSCRLRWMNYL 55
                     799*******************************************97 PP

2Myb_DNA-binding56.18.7e-1862106248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g ++ eE++l+v++ +qlG++ W++Iar+++ gRt++++k++w+++l
       KHN39021.1  62 GHFSVEEEQLIVQLQQQLGNK-WAKIARKLP-GRTDNEIKNFWRTHL 106
                      6799*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.113355IPR017930Myb domain
SuperFamilySSF466899.58E-276102IPR009057Homeodomain-like
SMARTSM007171.3E-12757IPR001005SANT/Myb domain
PfamPF002498.9E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-20962IPR009057Homeodomain-like
CDDcd001671.40E-81055No hitNo description
PROSITE profilePS5129425.59556110IPR017930Myb domain
SMARTSM007174.4E-1660108IPR001005SANT/Myb domain
PfamPF002491.5E-1562106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2463108IPR009057Homeodomain-like
CDDcd001672.08E-681106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MQGEHLRKGT WLQEEDEQLT SFVTRLGERR WDSLAKVAGL KRSGKSCRLR WMNYLRPNLK  60
HGHFSVEEEQ LIVQLQQQLG NKWAKIARKL PGRTDNEIKN FWRTHLRNRA QAQQVPGDFK  120
YKLEIATEEV NQKSIDMDSK DYKHGNVCCQ DSEWETKDGS SIDTLPLSDW ELGSSPYETR  180
ILDWIAELQN GYGDKELEQD CNSTGTCNNY SPQEFDEGCD SWDYSGSLWD MN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2561102105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0292641e-44AB029264.1 Glycine max gene for GmMYB7, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618278.11e-173PREDICTED: transcription factor MYB48-like
SwissprotQ9LX824e-46MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0B2RX511e-174A0A0B2RX51_GLYSO; Transcription factor MYB48
STRINGGLYMA10G06680.11e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.12e-52myb domain protein 27
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]